ELAVL4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ELAVL4 Antibody [NBP2-68648] - Staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ELAVL4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ELAVL4 Antibody - BSA Free (NBP2-68648) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK
• Predicted Species: Mouse (98%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELAVL4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  ELAVL4 Recombinant Protein Antigen (NBP2-68648PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for ELAVL4 Antibody - BSA Free

• abnormal vision, Drosophila, homolog of, like-4
• ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
• HuD
• Paraneoplastic encephalomyelitis antigen HuD

Background

ELAVL4 may play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, includingVEGF and FOS mRNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELAVL4