ELAC2 Antibody

Images

 
Western Blot: ELAC2 Antibody [NBP1-84620] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ELAC2 Antibody [NBP1-84620] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human testis shows strong nuclear and nucleolar positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: ELAC2 Antibody [NBP1-84620] - Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELAC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELAC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ELAC2 Protein (NBP1-84620PEP)
Publications
Read Publication using
NBP1-84620 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELAC2 Antibody

  • EC 3.1.26.11
  • elaC homolog 2 (E. coli)
  • ElaC homolog protein 2
  • ELC2
  • FLJ10530
  • FLJ36693
  • FLJ42848
  • Heredity prostate cancer protein 2
  • HPC2elaC (E. coli) homolog 2
  • putative prostate cancer susceptibility protein HPC2/ELAC2
  • Ribonuclease Z 2
  • RNase Z 2
  • tRNA 3 endonuclease 2
  • tRNase Z (long form)
  • tRNase Z 2
  • zinc phosphodiesterase ELAC protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-351
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC, IHC-P, KO, WB
NBP1-00092
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PLA, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-80830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP3-04894
Species: Hu
Applications: IHC, IHC-P, KO, WB
AF4036
Species: Hu
Applications: Simple Western, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03005
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-85337
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for ELAC2 Antibody (NBP1-84620)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ELAC2 Antibody (NBP1-84620) (0)

There are no reviews for ELAC2 Antibody (NBP1-84620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ELAC2 Antibody (NBP1-84620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELAC2 Products

Bioinformatics Tool for ELAC2 Antibody (NBP1-84620)

Discover related pathways, diseases and genes to ELAC2 Antibody (NBP1-84620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELAC2 Antibody (NBP1-84620)

Discover more about diseases related to ELAC2 Antibody (NBP1-84620).
 

Pathways for ELAC2 Antibody (NBP1-84620)

View related products by pathway.

PTMs for ELAC2 Antibody (NBP1-84620)

Learn more about PTMs related to ELAC2 Antibody (NBP1-84620).
 

Research Areas for ELAC2 Antibody (NBP1-84620)

Find related products by research area.

Blogs on ELAC2

There are no specific blogs for ELAC2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELAC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELAC2