ELA3A Antibody

Images

 
Western Blot: ELA3A Antibody [H00010136-D01P] - Analysis of ELA3A expression in human pancreas.
Western Blot: ELA3A Antibody [H00010136-D01P] - Analysis of ELA3A expression in transfected 293T cell line by ELA3A polyclonal antibody.Lane 1: ELA3A transfected lysate(29.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELA3A Antibody Summary

Immunogen
ELA3A (NP_005738.3, 1 a.a. - 270 a.a.) full-length human protein. MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH
Specificity
ELA3A - elastase 3A, pancreatic,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CELA3A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELA3A Antibody

  • chymotrypsin-like elastase family member 3A
  • chymotrypsin-like elastase family, member 3A
  • EC 3.4.21
  • EC 3.4.21.70
  • ELA3A
  • ELA3elastase 1
  • elastase 3A, pancreatic (protease E)
  • elastase 3A, pancreatic
  • Elastase IIIA
  • elastase-3A
  • Protease E

Background

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
H00006690-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00001990-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB5018
Species: Hu
Applications: IP, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
H00005670-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP3-15533
Species: Mu, Rt
Applications: ICC/IF, IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF4937
Species: Hu
Applications: IHC, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
DCRP00
Species: Hu
Applications: ELISA
AF3848
Species: Hu
Applications: IHC, IP, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P

Publications for ELA3A Antibody (H00010136-D01P) (0)

There are no publications for ELA3A Antibody (H00010136-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELA3A Antibody (H00010136-D01P) (0)

There are no reviews for ELA3A Antibody (H00010136-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELA3A Antibody (H00010136-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELA3A Products

Bioinformatics Tool for ELA3A Antibody (H00010136-D01P)

Discover related pathways, diseases and genes to ELA3A Antibody (H00010136-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ELA3A Antibody (H00010136-D01P)

Find related products by research area.

Blogs on ELA3A

There are no specific blogs for ELA3A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELA3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CELA3A
Entrez
Uniprot