eIF4G1 Recombinant Protein Antigen

Images

 
There are currently no images for eIF4G1 Protein (NBP1-84868PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

eIF4G1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF4G1.

Source: E. coli

Amino Acid Sequence: QAPTPLASHTVEIHEPNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSEPEEQAKEVTASVAPPTIPSATPATA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF4G1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84868.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for eIF4G1 Recombinant Protein Antigen

  • DKFZp686A1451
  • EIF4F
  • eIF-4G 1
  • eIF4G1
  • EIF-4G1
  • eIF-4-gamma 1
  • EIF4-gamma
  • EIF4GI
  • EIF4Gp220
  • eucaryotic translation initiation factor 4G
  • eukaryotic translation initiation factor 4 gamma 1
  • eukaryotic translation initiation factor 4 gamma, 1
  • P220

Background

eIF4G1 (eukaryotic translation Initiation Factor 4 Gamma 1) is a component of the protein complex eIF-4 which is involved in the recognition of the mRNA cap ATP-dependent unwinding of the terminal secondary structure and recruitment of mRNA to the ribosome. eIF4G plays a critical role in protein expression and is at the center of a complex regulatory network. Together with the cap-binding protein eIF4E, it recruits the small ribosomal subunit to the end of mRNA and promotes the assembly of a functional translation initiation complex which scans along the mRNA to the translation start codon. Human eIF4G contains three consecutive HEAT domains, as well as long unstructured regions involved in multiple protein-protein interactions. The interactions of eIF4G1 with other factors are largely unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC,  IHC-P, Simple Western, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
NBP1-85311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37488
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-16309
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00008569-M14
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00008894-M09
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF4589
Species: Hu
Applications: IHC, WB
291-G1
Species: Hu
Applications: BA
NBP3-24813
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84868PEP
Species: Hu
Applications: AC

Publications for eIF4G1 Protein (NBP1-84868PEP) (0)

There are no publications for eIF4G1 Protein (NBP1-84868PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4G1 Protein (NBP1-84868PEP) (0)

There are no reviews for eIF4G1 Protein (NBP1-84868PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for eIF4G1 Protein (NBP1-84868PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF4G1 Products

Research Areas for eIF4G1 Protein (NBP1-84868PEP)

Find related products by research area.

Blogs on eIF4G1

There are no specific blogs for eIF4G1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our eIF4G1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4G1