Recombinant Human eIF4G1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human eIF4G1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human EIF4G1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF4G1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eIF4G1 Protein

  • DKFZp686A1451
  • EIF4F
  • eIF-4G 1
  • eIF4G1
  • EIF-4G1
  • eIF-4-gamma 1
  • EIF4-gamma
  • EIF4GI
  • EIF4Gp220
  • eucaryotic translation initiation factor 4G
  • eukaryotic translation initiation factor 4 gamma 1
  • eukaryotic translation initiation factor 4 gamma, 1
  • P220

Background

EIF4G1 - eukaryotic translation initiation factor 4 gamma, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93308
Species: Hu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16309
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008569-M14
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
H00001981-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for eIF4G1 Partial Recombinant Protein (H00001981-Q01) (0)

There are no publications for eIF4G1 Partial Recombinant Protein (H00001981-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4G1 Partial Recombinant Protein (H00001981-Q01) (0)

There are no reviews for eIF4G1 Partial Recombinant Protein (H00001981-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF4G1 Partial Recombinant Protein (H00001981-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF4G1 Products

Bioinformatics Tool for eIF4G1 Partial Recombinant Protein (H00001981-Q01)

Discover related pathways, diseases and genes to eIF4G1 Partial Recombinant Protein (H00001981-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4G1 Partial Recombinant Protein (H00001981-Q01)

Discover more about diseases related to eIF4G1 Partial Recombinant Protein (H00001981-Q01).
 

Pathways for eIF4G1 Partial Recombinant Protein (H00001981-Q01)

View related products by pathway.

PTMs for eIF4G1 Partial Recombinant Protein (H00001981-Q01)

Learn more about PTMs related to eIF4G1 Partial Recombinant Protein (H00001981-Q01).
 

Research Areas for eIF4G1 Partial Recombinant Protein (H00001981-Q01)

Find related products by research area.

Blogs on eIF4G1

There are no specific blogs for eIF4G1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

eIF4G1 Antibody
NB100-268
4EBP1 Antibody
NB200-157

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eIF4G1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4G1
Entrez