EIF4EBP3 Antibody


Western Blot: EIF4EBP3 Antibody [NBP1-91867] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: EIF4EBP3 Antibody [NBP1-91867] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

EIF4EBP3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM
Specificity of human EIF4EBP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EIF4EBP3 Protein (NBP1-91867PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EIF4EBP3 Antibody

  • eIF4E-binding protein 3
  • eukaryotic translation initiation factor 4E binding protein 3,4E-BP3eukaryotic initiation factor 4E-binding protein 3
  • eukaryotic translation initiation factor 4E-binding protein 3,4EBP3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KO
Species: Hu, Mu, Rt, Po, Bv, Ca, Rb
Applications: WB, IHC
Species: Hu, Rt, Po
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IP, ICC
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu

Publications for EIF4EBP3 Antibody (NBP1-91867) (0)

There are no publications for EIF4EBP3 Antibody (NBP1-91867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF4EBP3 Antibody (NBP1-91867) (0)

There are no reviews for EIF4EBP3 Antibody (NBP1-91867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF4EBP3 Antibody (NBP1-91867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EIF4EBP3 Antibody (NBP1-91867)

Discover related pathways, diseases and genes to EIF4EBP3 Antibody (NBP1-91867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF4EBP3 Antibody (NBP1-91867)

Discover more about diseases related to EIF4EBP3 Antibody (NBP1-91867).

Pathways for EIF4EBP3 Antibody (NBP1-91867)

View related products by pathway.

PTMs for EIF4EBP3 Antibody (NBP1-91867)

Learn more about PTMs related to EIF4EBP3 Antibody (NBP1-91867).

Blogs on EIF4EBP3

There are no specific blogs for EIF4EBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EIF4EBP3 Antibody and receive a gift card or discount.


Gene Symbol EIF4EBP3