eIF4B Antibody

Images

 
Western Blot: eIF4B Antibody [NBP2-33284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: eIF4B Antibody [NBP2-33284] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Immunohistochemistry-Paraffin: eIF4B Antibody [NBP2-33284] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

eIF4B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
eIF4B Protein (NBP2-33284PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for eIF4B Antibody

  • Eif4a2
  • eIF4B
  • EIF-4B
  • eukaryotic translation initiation factor 4B
  • PRO1843

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83057
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-16289
Species: Hu
Applications: WB
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for eIF4B Antibody (NBP2-33284) (0)

There are no publications for eIF4B Antibody (NBP2-33284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4B Antibody (NBP2-33284) (0)

There are no reviews for eIF4B Antibody (NBP2-33284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF4B Antibody (NBP2-33284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF4B Products

Bioinformatics Tool for eIF4B Antibody (NBP2-33284)

Discover related pathways, diseases and genes to eIF4B Antibody (NBP2-33284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4B Antibody (NBP2-33284)

Discover more about diseases related to eIF4B Antibody (NBP2-33284).
 

Pathways for eIF4B Antibody (NBP2-33284)

View related products by pathway.

PTMs for eIF4B Antibody (NBP2-33284)

Learn more about PTMs related to eIF4B Antibody (NBP2-33284).
 

Research Areas for eIF4B Antibody (NBP2-33284)

Find related products by research area.

Blogs on eIF4B

There are no specific blogs for eIF4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4B
Entrez
Uniprot