eIF3K Antibody - BSA Free

Western Blot: eIF3K Antibody [NBP1-98396] - Mouse Liver lysate, concentration 1 ug/ml.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

eIF3K Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Eif3k - N-terminal region. Peptide sequence QILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF3K
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for eIF3K Antibody - BSA Free

• ARG134
• eIF3k
• EIF3-p28
• EIF3S12eIF-3 p28
• Eukaryotic translation initiation factor 3 subunit 12
• eukaryotic translation initiation factor 3 subunit K
• eukaryotic translation initiation factor 3, subunit 12
• eukaryotic translation initiation factor 3, subunit K
• HSPC029
• M9
• MSTP001
• muscle specific
• Muscle-specific gene M9 protein
• PLAC24
• PLAC-24
• PLAC-24eIF-3 p25
• PRO1474
• PTD001

Background

Eif3k is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF3K
• Uniprot:
  • NP_082935(Mouse)