EIF3G Antibody

Images

 
Western Blot: EIF3G Antibody [NBP1-84872] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: EIF3G Antibody [NBP1-84872] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: EIF3G Antibody [NBP1-84872] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF3G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF3G Protein (NBP1-84872PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIF3G Antibody

  • eIF3 p42
  • eIF3 p44
  • eIF-3-delta
  • eIF3-delta
  • eIF3g
  • EIF3-P42
  • eIF3-p44
  • EIF3S4eIF-3 RNA-binding subunit
  • Eukaryotic translation initiation factor 3 RNA-binding subunit
  • Eukaryotic translation initiation factor 3 subunit 4
  • eukaryotic translation initiation factor 3 subunit G
  • eukaryotic translation initiation factor 3 subunit p42
  • eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD)
  • eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa
  • eukaryotic translation initiation factor 3, subunit G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-24572
Species: Hu, Mu, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NB100-511
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP1-83007
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77997
Species: Hu, Mu, Rt, Bv, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-84872
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EIF3G Antibody (NBP1-84872) (0)

There are no publications for EIF3G Antibody (NBP1-84872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3G Antibody (NBP1-84872) (0)

There are no reviews for EIF3G Antibody (NBP1-84872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF3G Antibody (NBP1-84872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF3G Products

Bioinformatics Tool for EIF3G Antibody (NBP1-84872)

Discover related pathways, diseases and genes to EIF3G Antibody (NBP1-84872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3G Antibody (NBP1-84872)

Discover more about diseases related to EIF3G Antibody (NBP1-84872).
 

Pathways for EIF3G Antibody (NBP1-84872)

View related products by pathway.

PTMs for EIF3G Antibody (NBP1-84872)

Learn more about PTMs related to EIF3G Antibody (NBP1-84872).

Blogs on EIF3G

There are no specific blogs for EIF3G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF3G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3G