EIF3F Antibody - BSA Free

Western Blot: EIF3F Antibody [NBP2-13952] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunohistochemistry-Paraffin: EIF3F Antibody [NBP2-13952] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EIF3F Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EIF3F Antibody - BSA Free (NBP2-13952) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF3F
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EIF3F Protein (NBP2-13952PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EIF3F Antibody - BSA Free

• eIF3 p47
• eIF-3-epsilon
• eIF3-epsilon
• eIF3f
• eIF3-p47
• EIF3S5eukaryotic translation initiation factor 3 subunit F
• Eukaryotic translation initiation factor 3 subunit 5
• eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD)
• eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa
• eukaryotic translation initiation factor 3, subunit F

Background

eIF3f, also known as eukaryotic translation initiation factor 3 subunit 5, eIF-3 epsilon, and eIF3 p47 subunit, binds to the 40S ribosome and promotes the binding of methionyl-tRNA and mRNA. EIF3f also associates with the complex p170-eIF3. eIF-3 is composed of at least 12 different subunits, eIF3f is one of these subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF3F