EIF3F Antibody


Immunocytochemistry/ Immunofluorescence: EIF3F Antibody [NBP2-13952] - Staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: EIF3F Antibody [NBP2-13952] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

EIF3F Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFA KNMYELHKKVSPNELILGWYA
Specificity of human EIF3F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF3F Protein (NBP2-13952PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EIF3F Antibody

  • eIF3 p47
  • eIF-3-epsilon
  • eIF3-epsilon
  • eIF3f
  • eIF3-p47
  • EIF3S5eukaryotic translation initiation factor 3 subunit F
  • Eukaryotic translation initiation factor 3 subunit 5
  • eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD)
  • eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa
  • eukaryotic translation initiation factor 3, subunit F


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for EIF3F Antibody (NBP2-13952) (0)

There are no publications for EIF3F Antibody (NBP2-13952).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3F Antibody (NBP2-13952) (0)

There are no reviews for EIF3F Antibody (NBP2-13952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EIF3F Antibody (NBP2-13952) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EIF3F Products

Bioinformatics Tool for EIF3F Antibody (NBP2-13952)

Discover related pathways, diseases and genes to EIF3F Antibody (NBP2-13952). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3F Antibody (NBP2-13952)

Discover more about diseases related to EIF3F Antibody (NBP2-13952).

Pathways for EIF3F Antibody (NBP2-13952)

View related products by pathway.

PTMs for EIF3F Antibody (NBP2-13952)

Learn more about PTMs related to EIF3F Antibody (NBP2-13952).

Blogs on EIF3F

There are no specific blogs for EIF3F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EIF3F Antibody and receive a gift card or discount.


Gene Symbol EIF3F