RABIF/MSS4 Antibody

Images

 
Western Blot: RABIF/MSS4 Antibody [NBP1-81024] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: RABIF/MSS4 Antibody [NBP1-81024] - Staining of human testis shows cytoplasmic and nuclear positivity in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RABIF/MSS4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPD
Specificity
Specificity of human RABIF/MSS4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RABIF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RABIF/MSS4 Protein (NBP1-81024PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RABIF/MSS4 Antibody

  • mammalian suppressor of SEC4
  • mss4
  • MSS4guanine nucleotide exchange factor MSS4
  • RAB interacting factor
  • Rab-interacting factor
  • RASGFR3
  • RASGRF3
  • Ras-specific guanine-releasing factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-41206
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81024
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RABIF/MSS4 Antibody (NBP1-81024) (0)

There are no publications for RABIF/MSS4 Antibody (NBP1-81024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABIF/MSS4 Antibody (NBP1-81024) (0)

There are no reviews for RABIF/MSS4 Antibody (NBP1-81024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RABIF/MSS4 Antibody (NBP1-81024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RABIF/MSS4 Antibody (NBP1-81024)

Discover related pathways, diseases and genes to RABIF/MSS4 Antibody (NBP1-81024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABIF/MSS4 Antibody (NBP1-81024)

Discover more about diseases related to RABIF/MSS4 Antibody (NBP1-81024).
 

Pathways for RABIF/MSS4 Antibody (NBP1-81024)

View related products by pathway.

Research Areas for RABIF/MSS4 Antibody (NBP1-81024)

Find related products by research area.

Blogs on RABIF/MSS4

There are no specific blogs for RABIF/MSS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RABIF/MSS4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RABIF