We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

EIF3A Antibody - BSA Free

Images

 
Western Blot: EIF3A Antibody [NBP1-84876] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: EIF3A Antibody [NBP1-84876] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Staining of human testis.
Staining of human kidney.
Staining of human cerebral cortex.
Staining of human colon.
Orthogonal Strategies: Staining of human cerebral cortex, colon, kidney and testis HPA038315 (A) shows similar protein distribution across tissues to independent antibody HPA038316 (B).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

EIF3A Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EIF3A Protein (NBP1-84876PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EIF3A Antibody - BSA Free

  • centrosomin homolog
  • cytoplasmic protein p167
  • eIF3 p167
  • eIF3 p180
  • eIF3 p185
  • EIF3, p180 subunit
  • eIF3a
  • eIF3-p170
  • EIF3S10EIF3
  • eIF-3-theta
  • eIF3-theta
  • Eukaryotic translation initiation factor 3 subunit 10
  • eukaryotic translation initiation factor 3 subunit A
  • eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD)
  • eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD)
  • eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa
  • eukaryotic translation initiation factor 3, subunit 10, 170kD
  • eukaryotic translation initiation factor 3, subunit A
  • KIAA0139P167
  • p180
  • p185
  • TIF32

Background

Eukaryotic initiation factor 3 subunit A (eIF3A) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3A is also known as EIF3S10 (eukaryotic initiation factor 3 subunit 7). eIF3A is the largest subunit of the eIF3 complex. eIF3A expression is regulated through the cell cycle. It's expression peaks in S-phase and it is proposed to play a role in regulating the translation of mRNAs involved in the regulation of cell cycle progression and proliferation. Alternative names for eIF3A include eIF-3-theta, eIF-3 p167, eIF-3 p170, eIF-3 p180, eIF3-p185, EIF3S10, and KIAA0139.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1129-ER
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB6860
Species: Hu
Applications: IP, WB
236-EG
Species: Hu
Applications: BA
NBP2-49695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
H00010714-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-38597
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-351
Species: Ha, Hu, Mu
Applications: IHC,  IHC-P, IP, WB

Publications for EIF3A Antibody (NBP1-84876) (0)

There are no publications for EIF3A Antibody (NBP1-84876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3A Antibody (NBP1-84876) (0)

There are no reviews for EIF3A Antibody (NBP1-84876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF3A Antibody (NBP1-84876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF3A Products

Research Areas for EIF3A Antibody (NBP1-84876)

Find related products by research area.

Blogs on EIF3A

There are no specific blogs for EIF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF3A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3A