EIF3A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EIF3A Antibody [NBP1-84875] - Staining of human cell line A-431 shows positivity in nucleus and cytoplasm.
Immunohistochemistry-Paraffin: EIF3A Antibody [NBP1-84875] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF3A Protein (NBP1-84875PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIF3A Antibody

  • centrosomin homolog
  • cytoplasmic protein p167
  • eIF3 p167
  • eIF3 p180
  • eIF3 p185
  • EIF3, p180 subunit
  • eIF3a
  • eIF3-p170
  • EIF3S10EIF3
  • eIF-3-theta
  • eIF3-theta
  • Eukaryotic translation initiation factor 3 subunit 10
  • eukaryotic translation initiation factor 3 subunit A
  • eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD)
  • eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD)
  • eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa
  • eukaryotic translation initiation factor 3, subunit 10, 170kD
  • eukaryotic translation initiation factor 3, subunit A
  • KIAA0139P167
  • p180
  • p185
  • TIF32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
MAB6860
Species: Hu
Applications: WB, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84875
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for EIF3A Antibody (NBP1-84875) (0)

There are no publications for EIF3A Antibody (NBP1-84875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3A Antibody (NBP1-84875) (0)

There are no reviews for EIF3A Antibody (NBP1-84875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EIF3A Antibody (NBP1-84875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF3A Products

Bioinformatics Tool for EIF3A Antibody (NBP1-84875)

Discover related pathways, diseases and genes to EIF3A Antibody (NBP1-84875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3A Antibody (NBP1-84875)

Discover more about diseases related to EIF3A Antibody (NBP1-84875).
 

Pathways for EIF3A Antibody (NBP1-84875)

View related products by pathway.

PTMs for EIF3A Antibody (NBP1-84875)

Learn more about PTMs related to EIF3A Antibody (NBP1-84875).
 

Research Areas for EIF3A Antibody (NBP1-84875)

Find related products by research area.

Blogs on EIF3A

There are no specific blogs for EIF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3A