EHD3 Antibody - BSA Free

Western Blot: EHD3 Antibody [NBP2-87339] - Host: Rabbit. Target Name: EHD3. Sample Tissue: Human PC-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

EHD3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EHD3. Peptide sequence: DNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EHD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for EHD3 Antibody - BSA Free

• EH domain containing 3
• EH domain-containing protein 3
• EHD2
• EH-domain containing 3
• PAST homolog 3
• PAST3

Background

The deduced protein identities between EHD1 and EHD2, between EHD1 and EHD3, and between EHD1 and EHD4, are 71%, 86%, and 76%, respectively. All contain multiple conserved regions that include a nucleotide binding consensus site at the N terminus, a bipartite nuclear localization signal, and an eps15 homology (EH) protein binding domain with an EF hand motif at the C terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EHD3