EG-VEGF/PK1 Antibody (1B4G2)

Western Blot: EG-VEGF/PK1 Antibody (1B4G2) [EG-VEGF/PK1] - Western blot analysis of various lysates using PROK1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: EG-VEGF/PK1 Antibody (1B4G2) [EG-VEGF/PK1] - Immunofluorescence analysis of paraffin-embedded human placenta using PROK1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: EG-VEGF/PK1 Antibody (1B4G2) [EG-VEGF/PK1] - Immunofluorescence analysis of paraffin-embedded rat placenta using PROK1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 1B4G2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

EG-VEGF/PK1 Antibody (1B4G2) Summary

• Description: Novus Biologicals Rabbit EG-VEGF/PK1 Antibody (1B4G2) (NBP3-15678) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human EG-VEGF/PK1 (P58294). MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PROK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EG-VEGF/PK1 Antibody (1B4G2)

• EGVEGF
• EG-VEGF
• EGVEGFblack mamba toxin-related protein
• Endocrine-gland-derived vascular endothelial growth factor
• Mambakine
• PK1mambakine
• PRK1prokineticin-1
• PROK1
• Prokineticin 1

Background

Prokineticin 1 potently contracts gastrointestinal (GI) smooth muscle. It induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands and has little or no effect on a variety of other endothelial and non-endothelial cell types.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PROK1