eEF1A2 binding protein Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: eEF1A2 binding protein Antibody [NBP2-48962] - Analysis of human cell line HeLa shows positivity in cytokinetic bridge.

Immunohistochemistry-Paraffin: eEF1A2 binding protein Antibody [NBP2-48962] - Analysis in human skeletal muscle and liver tissues using NBP2-48962 antibody. Corresponding IGFN1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: eEF1A2 binding protein Antibody [NBP2-48962] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.

Immunohistochemistry-Paraffin: eEF1A2 binding protein Antibody [NBP2-48962] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: eEF1A2 binding protein Antibody [NBP2-48962] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: eEF1A2 binding protein Antibody [NBP2-48962] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

eEF1A2 binding protein Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGFN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  eEF1A2 binding protein Recombinant Protein Antigen (NBP2-48962PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for eEF1A2 binding protein Antibody - BSA Free

• DKFZp434B1231
• eEF1A2 binding protein
• EEF1A2-binding protein 1
• EEF1A2BP1
• immunoglobulin-like and fibronectin type III domain containing 1
• immunoglobulin-like and fibronectin type III domain-containing protein 1
• KY-interacting protein 1
• KYIP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGFN1