LSM14A Antibody

Images

 
Western Blot: LSM14A Antibody [NBP1-88473] - Analysis in human cell line Daudi.
Immunocytochemistry/ Immunofluorescence: LSM14A Antibody [NBP1-88473] - Staining of human cell line A-431 shows positivity in vesicles.
Immunohistochemistry-Paraffin: LSM14A Antibody [NBP1-88473] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: LSM14A Antibody [NBP1-88473] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LSM14A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LSM14A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LSM14A Protein (NBP1-88473PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LSM14A Antibody

  • alphaSNBP
  • C19orf13
  • DKFZP434D1335
  • FAM61A
  • family with sequence similarity 61, member A
  • hRAP55
  • hRAP55A
  • LSM14 homolog A
  • LSM14A, SCD6 homolog A (S. cerevisiae)
  • Protein FAM61A
  • protein LSM14 homolog A
  • Protein SCD6 homolog
  • Putative alpha-synuclein-binding protein
  • RAP55ALSM14 homolog A (SCD6, S. cerevisiae)
  • RAP55chromosome 19 open reading frame 13
  • RNA-associated protein 55
  • RNA-associated protein 55A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16267
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00055802-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-89390
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92538
Species: Hu
Applications: WB, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-93336
Species: Hu
Applications: WB, IP
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-82076
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP1-88473
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LSM14A Antibody (NBP1-88473) (0)

There are no publications for LSM14A Antibody (NBP1-88473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSM14A Antibody (NBP1-88473) (0)

There are no reviews for LSM14A Antibody (NBP1-88473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LSM14A Antibody (NBP1-88473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LSM14A Products

Bioinformatics Tool for LSM14A Antibody (NBP1-88473)

Discover related pathways, diseases and genes to LSM14A Antibody (NBP1-88473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSM14A Antibody (NBP1-88473)

Discover more about diseases related to LSM14A Antibody (NBP1-88473).
 

Pathways for LSM14A Antibody (NBP1-88473)

View related products by pathway.

PTMs for LSM14A Antibody (NBP1-88473)

Learn more about PTMs related to LSM14A Antibody (NBP1-88473).

Blogs on LSM14A

There are no specific blogs for LSM14A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LSM14A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LSM14A