Reactivity | HuSpecies Glossary |
Applications | ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS |
Specificity | Specificity of human EDA2R/TNFRSF27/XEDAR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | EDA2R |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618)Discover more about diseases related to EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618).
| Pathways for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618)View related products by pathway.
|
PTMs for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618)Learn more about PTMs related to EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | EDA2R |