EDA2R/TNFRSF27/XEDAR Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EDA2R/TNFRSF27/XEDAR Antibody [NBP2-58618] - Staining of human cell line U-2 OS shows localization to cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EDA2R/TNFRSF27/XEDAR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS
Specificity
Specificity of human EDA2R/TNFRSF27/XEDAR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDA2R
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EDA2R/TNFRSF27/XEDAR Recombinant Protein Antigen (NBP2-58618PEP)

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EDA2R/TNFRSF27/XEDAR Antibody

  • ectodysplasin A2 receptor
  • EDA2R
  • EDA-A2 receptor
  • EDAA2R
  • EDA-A2R
  • EDAA2Rtumor necrosis factor receptor superfamily member XEDAR
  • EDAR2
  • TNFRSF27
  • XEDAR
  • XEDARTNFRSF27tumor necrosis factor receptor superfamily member 27
  • X-linked ectodysplasin-A2 receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF745
Species: Mu
Applications: WB, Block
NBP2-81908
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB120-12126
Species: Hu, Mu
Applications: WB
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-58618
Species: Hu
Applications: ICC/IF

Publications for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618) (0)

There are no publications for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618) (0)

There are no reviews for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EDA2R/TNFRSF27/XEDAR Products

Bioinformatics Tool for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618)

Discover related pathways, diseases and genes to EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618)

Discover more about diseases related to EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618).
 

Pathways for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618)

View related products by pathway.

PTMs for EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618)

Learn more about PTMs related to EDA2R/TNFRSF27/XEDAR Antibody (NBP2-58618).

Blogs on EDA2R/TNFRSF27/XEDAR

There are no specific blogs for EDA2R/TNFRSF27/XEDAR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EDA2R/TNFRSF27/XEDAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDA2R