![Immunohistochemistry-Paraffin: ECM-1/Secretory Component P85 Antibody [NBP3-16986] - Staining of human epididymis shows high expression.](http://images.novusbio.com/fullsize/ECM-1-Secretory-Component-P85-Antibody-Immunohistochemistry-Paraffin-NBP3-16986-img0002.jpg "Immunohistochemistry-Paraffin: ECM-1/Secretory Component P85 Antibody [NBP3-16986] - Staining of human epididymis shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ECM1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ECM-1/Secretory Component P85 Antibody (NBP3-16986)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ECM1 |
![Immunohistochemistry-Paraffin: ECM-1/Secretory Component P85 Antibody [NBP3-16986] - Analysis in human epididymis and lymph node tissues using Anti-ECM1 antibody. Corresponding ECM1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ECM-1-Secretory-Component-P85-Antibody-Immunohistochemistry-Paraffin-NBP3-16986-img0001.jpg "Immunohistochemistry-Paraffin: ECM-1/Secretory Component P85 Antibody [NBP3-16986] - Analysis in human epididymis and lymph node tissues using Anti-ECM1 antibody. Corresponding ECM1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ECM-1/Secretory Component P85 Antibody [NBP3-16986] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/ECM-1-Secretory-Component-P85-Antibody-Immunohistochemistry-Paraffin-NBP3-16986-img0003.jpg "Immunohistochemistry-Paraffin: ECM-1/Secretory Component P85 Antibody [NBP3-16986] - Staining of human lymph node shows low expression as expected.")
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![Western Blot PI 3-Kinase p85 beta Antibody (572001) [Unconjugated]](https://images.novusbio.com/images2/PI_3-Kinase_p85_beta_MAB6777_Western_Blot_10847.jpg)
![Immunocytochemistry PI 3-Kinase p85 beta Antibody (572001) [Unconjugated]](https://images.novusbio.com/images2/PI_3Kinase_p85_beta_MAB6777_Immunocytochemistry__Immunofluorescence_20216.jpg)
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/Angiopoietin-2_DANG20_ELISA_30.jpg)
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/DATA_Angiopoietin2_DANG20_ELISA_574.jpg)
![Neutralization IL-23R Antibody (258010) [Unconjugated]](https://images.novusbio.com/images2/IL-23_R_MAB1686_Block_Neutralize_9037.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")