TMPRSS4 Antibody

Western Blot: TMPRSS4 Antibody [NBP1-56991] - HepG2 cell lysate analyzed by Western blot at a concentration of 0.2-1 ug/ml. The observed molecular weight is represented by the band appearing at approximately 48 kDa.

Western Blot: TMPRSS4 Antibody [NBP1-56991] - Human breast cancer cell line SKBR3 and Positive control. Image from verified customer review. The observed molecular weight is represented at the band appearing at 48 kDa.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

TMPRSS4 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: TMPRSS4 Antibody is a synthetic peptides corresponding to TMPRSS4 (transmembrane protease, serine 4) The peptide sequence was selected from the middle region of TMPRSS4. Peptide sequence LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMPRSS4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TMPRSS4 Antibody

• CAPH2
• Channel-activating protease 2
• EC 3.4.21
• EC 3.4.21.4
• EC 3.4.21.43
• Membrane-type serine protease 2
• MT-SP2
• TMPRSS3EC 3.4.21.-
• TMPRSS4
• transmembrane protease serine 4
• transmembrane protease, serine 4
• transmembrane serine protease 3
• Type II membrane serine protease

Background

TMPRSS4, previously known as TMPRSS3, is a 437 amino acid type II transmembrane serine protease located on human chromosome 11q23.3 that encodes 5 isoforms containing a complete coding sequence. This serine protease has a predicted molecular weight of 48 kDa with 2 glycosylation sites and the cleaved soluble protease domain has been detected in cell culture media. Functions of TMPRSS4 include embryo development, viral infection, and cancer. TMPRSS4 plays a role in the epithelial-mesenchymal transition (EMT) process and mediates cell invasion, migration, proliferation and metastasis. Overexpression of TMPRSS4 has been reported for multiple solid tumors including pancreatic, ovarian, thyroid, colorectal, lung, breast, cervical, gallbladder, gastric, and liver cancer, and has been associated with poor overall survival and reduced time to tumor progression (1,2).
TMPRSS4 has also been shown to play a role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 or potentially by TMPRSS4 at the cell surface to facilitate viral entry (3).
References

1. L de Aberasturi A, Calvo A. (2015) TMPRSS4: An Emerging Potential Therapeutic Target in Cancer. Br J Cancer. 112(1):4-8. PMID: 25203520

2. Zeng P., Zhang P., Zhou L., Tang M., Shen Y., Jin J., Zhu Y., Chen M. (2016) TMPRSS4 as an emerging potential poor prognostic factor for solid tumors: A systematic review and meta-analysis. Oncotarget. 7:76327-76336. PMID: 27344186

3. Zang F, Castro MFG, McCune BT, Zeng Q, Rothlauf PW, Sonnek NM, Liu Z, Brulois KF, Wang X, Greenberg HB, Diamond MS, Ciorba MA, Whelan SPJ, and Ding S. (2020) TMPRSS2 and TMPRSS4 promote SARS-CoV-2 infection of human small intestinal enterocytes. Sci Immunol. 5(47): eabc3582. PMID: 32404436

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for TMPRSS4 Antibody (NBP1-56991) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 08/15/2014

Summary

• Application: Western Blot
• Sample Tested: Human breast cancer cell line SKBR3 and Positive control
• Species: Human
• Lot: QC29156

Bioinformatics

• Gene Symbol: TMPRSS4
• Uniprot:
  • Q9NRS4-2(Human)