TMPRSS4 Antibody

Images

 
Western Blot: TMPRSS4 Antibody [NBP1-56991] - HepG2 cell lysate analyzed by Western blot at a concentration of 0.2-1 ug/ml. The observed molecular weight is represented by the band appearing at approximately 48 kDa.
Western Blot: TMPRSS4 Antibody [NBP1-56991] - Human breast cancer cell line SKBR3 and Positive control. Image from verified customer review. The observed molecular weight is represented at the band appearing at 48 kDa.

Product Details

Summary
Reactivity Hu, Hu, Mu, Po, Pm, FeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMPRSS4 Antibody Summary

Immunogen
TMPRSS4 Antibody is a synthetic peptides corresponding to TMPRSS4 (transmembrane protease, serine 4) The peptide sequence was selected from the middle region of TMPRSS4. Peptide sequence LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMPRSS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMPRSS4 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-56991 in the following application:

Reactivity Notes

Predicted cross-reactivity based on sequence identity: Gibbon (98%), Marmoset (98%), Chimpanzee (96%), Feline (90%), Mouse (90%), Panda (90%), Porcine (90%)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMPRSS4 Antibody

  • CAPH2
  • Channel-activating protease 2
  • EC 3.4.21
  • EC 3.4.21.4
  • EC 3.4.21.43
  • Membrane-type serine protease 2
  • MT-SP2
  • TMPRSS3EC 3.4.21.-
  • TMPRSS4
  • transmembrane protease serine 4
  • transmembrane protease, serine 4
  • transmembrane serine protease 3
  • Type II membrane serine protease

Background

TMPRSS4, previously known as TMPRSS3, is a 437 amino acid type II transmembrane serine protease located on human chromosome 11q23.3 that encodes 5 isoforms containing a complete coding sequence. This serine protease has a predicted molecular weight of 48 kDa with 2 glycosylation sites and the cleaved soluble protease domain has been detected in cell culture media. Functions of TMPRSS4 include embryo development, viral infection, and cancer. TMPRSS4 plays a role in the epithelial-mesenchymal transition (EMT) process and mediates cell invasion, migration, proliferation and metastasis. Overexpression of TMPRSS4 has been reported for multiple solid tumors including pancreatic, ovarian, thyroid, colorectal, lung, breast, cervical, gallbladder, gastric, and liver cancer, and has been associated with poor overall survival and reduced time to tumor progression (1,2).
TMPRSS4 has also been shown to play a role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 or potentially by TMPRSS4 at the cell surface to facilitate viral entry (3).
References

1. L de Aberasturi A, Calvo A. (2015) TMPRSS4: An Emerging Potential Therapeutic Target in Cancer. Br J Cancer. 112(1):4-8. PMID: 25203520

2. Zeng P., Zhang P., Zhou L., Tang M., Shen Y., Jin J., Zhu Y., Chen M. (2016) TMPRSS4 as an emerging potential poor prognostic factor for solid tumors: A systematic review and meta-analysis. Oncotarget. 7:76327-76336. PMID: 27344186

3. Zang F, Castro MFG, McCune BT, Zeng Q, Rothlauf PW, Sonnek NM, Liu Z, Brulois KF, Wang X, Greenberg HB, Diamond MS, Ciorba MA, Whelan SPJ, and Ding S. (2020) TMPRSS2 and TMPRSS4 promote SARS-CoV-2 infection of human small intestinal enterocytes. Sci Immunol. 5(47): eabc3582. PMID: 32404436

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
AF3946
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
4776-SE
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-20984
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-82991
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NB120-3481
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm
Applications: WB, IHC
AF2209
Species: Hu
Applications: WB, ELISA, IHC
AF3937
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-45831
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-93879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP3-03833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-56991
Species: Hu, Hu, Mu, Po, Pm, Fe
Applications: WB

Publications for TMPRSS4 Antibody (NBP1-56991) (0)

There are no publications for TMPRSS4 Antibody (NBP1-56991).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TMPRSS4 Antibody (NBP1-56991) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-56991:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TMPRSS4 NBP1-56991
Enlarge
5
reviewed by:
Ming Lu
WB Human 08/15/2014
View

Summary

ApplicationWestern Blot
Sample TestedHuman breast cancer cell line SKBR3 and Positive control
SpeciesHuman
LotQC29156
CommentsTMPRSS4 is not easy to work with due to low expression level in the cancer lines I work with. Thanks to Novusbio who offers positive control for this TMPRSS4 antibody, now I am confident about the result I got.

Blocking

Blocking Details2% cold fish geletin in TBS buffer, room temperature for 1hour

Primary Anitbody

Dilution Ratio1:1000 overnight at 4C in blocking buffer

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#Cell Signaling, #7074
Secondary Concentration1:5000

Details

Detection Notes1 min exposure shows band at correct MW.

Comments

CommentsTMPRSS4 is not easy to work with due to low expression level in the cancer lines I work with. Thanks to Novusbio who offers positive control for this TMPRSS4 antibody, now I am confident about the result I got.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMPRSS4 Antibody (NBP1-56991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMPRSS4 Products

Bioinformatics Tool for TMPRSS4 Antibody (NBP1-56991)

Discover related pathways, diseases and genes to TMPRSS4 Antibody (NBP1-56991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMPRSS4 Antibody (NBP1-56991)

Discover more about diseases related to TMPRSS4 Antibody (NBP1-56991).
 

Pathways for TMPRSS4 Antibody (NBP1-56991)

View related products by pathway.

PTMs for TMPRSS4 Antibody (NBP1-56991)

Learn more about PTMs related to TMPRSS4 Antibody (NBP1-56991).
 

Research Areas for TMPRSS4 Antibody (NBP1-56991)

Find related products by research area.

Blogs on TMPRSS4

There are no specific blogs for TMPRSS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Ming Lu
08/15/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol TMPRSS4
Uniprot