EBI3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-27/IL-35 EBI3 Subunit. Source: E. coli
Amino Acid Sequence: SPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
EBI3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48852. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for EBI3 Recombinant Protein Antigen
Background
EBI3 gene encodes a 229 amino acid long, 25 kDA interleukin-27 subunit beta protein that is member to the hematopoitetin receptor family. These proteins obtain pro as well as anti-inflammatory properties and have roles in T-helper cell development, suppressing cell proliferation, encouraging cytotoxic T-cell activity, and can induce isotope switching in B cells. EBI3 participates in Th1 differentiation, IL-2 signaling (and its primary biological effects in various immune cells), as well as IL27-mediated signaling events. EBI3 interacts with genes IL27, IL12A, CANX, MDF1, and SMAD3. It has been associated and researched in sepsis, asthma, carcinoma, Chron's disease, b-cell lymphomas, ulcerative colitis, Hodgkin disease, lymphoma, ebv infections, and glomerulonephritis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: AC
Publications for EBI3 Recombinant Protein Antigen (NBP2-48852PEP) (0)
There are no publications for EBI3 Recombinant Protein Antigen (NBP2-48852PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EBI3 Recombinant Protein Antigen (NBP2-48852PEP) (0)
There are no reviews for EBI3 Recombinant Protein Antigen (NBP2-48852PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for EBI3 Recombinant Protein Antigen (NBP2-48852PEP) (0)
Additional EBI3 Products
Research Areas for EBI3 Recombinant Protein Antigen (NBP2-48852PEP)
Find related products by research area.
|
Blogs on EBI3