EAAT2/GLT1 Antibody


Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Staining of human rectum shows low expression as expected.
Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Staining of human hippocampus shows distinct positivity in subsets of glial cells.
Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Staining in human cerebral cortex and rectum tissues using anti-SLC1A2 antibody. Corresponding SLC1A2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

EAAT2/GLT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
Specificity of human EAAT2/GLT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EAAT2/GLT1 Protein (NBP1-84027PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EAAT2/GLT1 Antibody

  • EAAT2
  • GLT1
  • member 2
  • SLC1A2
  • solute carrier family 1 (glial high affinity glutamate transporter), member 2
  • Solute carrier family 1 member 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P

Publications for EAAT2/GLT1 Antibody (NBP1-84027) (0)

There are no publications for EAAT2/GLT1 Antibody (NBP1-84027).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAAT2/GLT1 Antibody (NBP1-84027) (0)

There are no reviews for EAAT2/GLT1 Antibody (NBP1-84027). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for EAAT2/GLT1 Antibody (NBP1-84027) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EAAT2/GLT1 Products

Bioinformatics Tool for EAAT2/GLT1 Antibody (NBP1-84027)

Discover related pathways, diseases and genes to EAAT2/GLT1 Antibody (NBP1-84027). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EAAT2/GLT1 Antibody (NBP1-84027)

Discover more about diseases related to EAAT2/GLT1 Antibody (NBP1-84027).

Pathways for EAAT2/GLT1 Antibody (NBP1-84027)

View related products by pathway.

PTMs for EAAT2/GLT1 Antibody (NBP1-84027)

Learn more about PTMs related to EAAT2/GLT1 Antibody (NBP1-84027).

Blogs on EAAT2/GLT1

There are no specific blogs for EAAT2/GLT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EAAT2/GLT1 Antibody and receive a gift card or discount.


Gene Symbol SLC1A2