EAAT2/GLT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Analysis in human cerebral cortex and fallopian tube tissues using NBP1-84027 antibody. Corresponding EAAT2/GLT1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-84027] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Staining of human cerebral cortex shows strong membranous positivity in neuropil.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EAAT2/GLT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC1A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EAAT2/GLT1 Protein (NBP1-84027PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EAAT2/GLT1 Antibody - BSA Free

• EAAT2
• GLT1
• member 2
• SLC1A2
• solute carrier family 1 (glial high affinity glutamate transporter), member 2
• Solute carrier family 1 member 2

Background

GLT1 is the major glial glutamate transporter that takes up more than 90% of glutamate from the synapse. GLT1b is a splice variant that contains 11 unique amino acids at the C-terminus that encode a PDZ binding domain. GLT1b was initially believed to be the neuronal isoform of GLT1, but it now appears that GLT1b is localized to astrocytes in the normal brain and to neurons in pathological conditions. In Lou Gehrig's Disease, GLT1a is decreased, while GLT1b is increased. There are also different expressions in hypoxic cells, which have not yet been fully elucidated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC1A2