EAAT1/GLAST-1/SLC1A3 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC1A3. Source: E. coli
Amino Acid Sequence: NGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
SLC1A3 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84940. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for EAAT1/GLAST-1/SLC1A3 Recombinant Protein Antigen
Background
Human excitatory amino acid transporters (EAATs) are members of a family of high affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system. It is believed that these proteins reduce extracellular glutamate concentration, thereby modulating synaptic signaling. In addition, EAATs may also be important for the prevention of glutamate excitotoxicity. EAAT1 is prominently expressed in the frontal cortex, hippocampus and basal ganglia and is also reported to be found in heart, placenta, lung and striated muscle. EAAT1 shares some pharmacological similarities with EAAT3 and both are potent antagonists that appear to specifically block transport mediated by EAAT2. EAAT1 transports L-glutamate and also L- and D-aspartate, acting as a symport by co-transporting sodium. EAAT1 is essential for terminating the postsynaptic action of glutamate, by rapidly removing released glutamate from the synaptic cleft.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, In vivo, ISH, WB
Species: Hu, Rt
Applications: ICC/IF, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: AC
Publications for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84940PEP) (0)
There are no publications for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84940PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84940PEP) (0)
There are no reviews for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84940PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84940PEP) (0)
Additional EAAT1/GLAST-1/SLC1A3 Products
Research Areas for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84940PEP)
Find related products by research area.
|
Blogs on EAAT1/GLAST-1/SLC1A3