EAAT1/GLAST-1/SLC1A3 Recombinant Protein Antigen

Images

 
There are currently no images for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EAAT1/GLAST-1/SLC1A3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC1A3.

Source: E. coli

Amino Acid Sequence: LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC1A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84939.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EAAT1/GLAST-1/SLC1A3 Recombinant Protein Antigen

  • EA6
  • EA6FLJ25094
  • EAAT1
  • EAAT1GLAST-1
  • excitatory amino acid transporter 1
  • GLAST1
  • GLAST-1
  • GLASTGLAST1
  • SLC1A3
  • Sodium-dependent glutamate/aspartate transporter 1
  • solute carrier family 1 (glial high affinity glutamate transporter), member 3
  • Solute carrier family 1 member 3

Background

Human excitatory amino acid transporters (EAATs) are members of a family of high affinity sodium-dependent transporter molecules that regulate neurotransmitter concentrations at the excitatory glutamatergic synapses of the mammalian central nervous system. It is believed that these proteins reduce extracellular glutamate concentration, thereby modulating synaptic signaling. In addition, EAATs may also be important for the prevention of glutamate excitotoxicity. EAAT1 is prominently expressed in the frontal cortex, hippocampus and basal ganglia and is also reported to be found in heart, placenta, lung and striated muscle. EAAT1 shares some pharmacological similarities with EAAT3 and both are potent antagonists that appear to specifically block transport mediated by EAAT2. EAAT1 transports L-glutamate and also L- and D-aspartate, acting as a symport by co-transporting sodium. EAAT1 is essential for terminating the postsynaptic action of glutamate, by rapidly removing released glutamate from the synaptic cleft.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-20136
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, In vivo, ISH, WB
NBP2-59319
Species: Hu, Rt
Applications: ICC/IF, IP, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-81802
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC,  IHC-P, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-13165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NB300-126
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-84939PEP
Species: Hu
Applications: AC

Publications for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP) (0)

There are no publications for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP) (0)

There are no reviews for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EAAT1/GLAST-1/SLC1A3 Products

Research Areas for EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84939PEP)

Find related products by research area.

Blogs on EAAT1/GLAST-1/SLC1A3

There are no specific blogs for EAAT1/GLAST-1/SLC1A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EAAT1/GLAST-1/SLC1A3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC1A3