Dystonin Antibody (1D2)

Images

 
Immunocytochemistry/ Immunofluorescence: Dystonin Antibody (1D2) [H00000667-M02] - Analysis of monoclonal antibody to DST on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Dystonin Antibody (1D2) [H00000667-M02] - Detection limit for recombinant GST tagged DST is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dystonin Antibody (1D2) Summary

Immunogen
DST (NP_899236 401 a.a. - 500 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DST
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dystonin Antibody (1D2)

  • 230 kDa bullous pemphigoid antigen
  • BP240
  • BPAFLJ30627
  • BPAG1FLJ32235
  • Bullous pemphigoid antigen 1
  • bullous pemphigoid antigen 1, 230/240kDa
  • Bullous pemphigoid antigen
  • CATX-15
  • D6S1101
  • DKFZp564B2416
  • DMHCATX15
  • DT
  • Dystonia musculorum protein
  • dystonin
  • FLJ13425
  • FLJ21489
  • FLJ46791
  • Hemidesmosomal plaque protein
  • KIAA0465
  • KIAA0728
  • KIAA1470
  • MACF2
  • trabeculin-beta

Background

This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been known that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
259-HE
Species: Hu
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00000667-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Dystonin Antibody (H00000667-M02) (0)

There are no publications for Dystonin Antibody (H00000667-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystonin Antibody (H00000667-M02) (0)

There are no reviews for Dystonin Antibody (H00000667-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dystonin Antibody (H00000667-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dystonin Products

Bioinformatics Tool for Dystonin Antibody (H00000667-M02)

Discover related pathways, diseases and genes to Dystonin Antibody (H00000667-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dystonin Antibody (H00000667-M02)

Discover more about diseases related to Dystonin Antibody (H00000667-M02).
 

Pathways for Dystonin Antibody (H00000667-M02)

View related products by pathway.

PTMs for Dystonin Antibody (H00000667-M02)

Learn more about PTMs related to Dystonin Antibody (H00000667-M02).
 

Research Areas for Dystonin Antibody (H00000667-M02)

Find related products by research area.

Blogs on Dystonin

There are no specific blogs for Dystonin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dystonin Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol DST
Uniprot