DUSP14 Antibody - BSA Free

Western Blot: DUSP14 Antibody [NBP3-35121] - Western blot analysis of various lysates using DUSP14 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: DUSP14 Antibody [NBP3-35121] - Immunofluorescence analysis of H9C2 cells using DUSP14 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DUSP14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DUSP14 Antibody - BSA Free (NBP3-35121) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DUSP14 (NP_008957.1).
  
  Sequence:
  MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:200 - 1:2000
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DUSP14 Antibody - BSA Free

• dual specificity phosphatase 14
• EC 3.1.3.16
• EC 3.1.3.48
• MAP kinase phosphatase 6
• Mitogen-activated protein kinase phosphatase 6
• MKP-1 like protein tyrosine phosphatase
• MKP-1-like protein tyrosine phosphatase
• MKP-6
• MKP6MKP-Ldual specificity protein phosphatase 14

Background

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-basedprotein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosineand serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP(mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009(PubMed 19228121)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP14