DTX4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows strong cytoplasmic positivity in neurons of the motor trigeminal nucleus.

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human hippocampus shows moderate granular immunoreactivity in neuronal cell bodies.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse hippocampus shows restricted positivity in the CA2/CA3 areas.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse olfactory bulb shows weak staining in the external plexiform layer.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows cytoplasmic staining in the vestibular nucleus.

Immunocytochemistry/Immunofluorescence: DTX4 Antibody [NBP2-32448] - Immunofluorescent staining of human cell line CACO-2 shows localization to vesicles.

Immunohistochemistry: DTX4 Antibody [NBP2-32448] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human cerebellum shows strong granular cytoplasmic immunoreactivity in Purkinje cells.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DTX4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DTX4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DTX4 Protein (NBP2-32448PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DTX4 Antibody - BSA Free

• Deltex 4 Homolog (Drosophila)
• Deltex 4 Homolog
• Deltex Homolog 4 (Drosophila)
• deltex4
• DTX4
• E3 Ubiquitin-Protein Ligase DTX4
• EC 6.3.2.
• KIAA0937
• Protein Deltex-4
• RING Finger Protein 155
• RNF155

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DTX4