DTX4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows strong cytoplasmic positivity in neurons of the motor trigeminal nucleus.
Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human hippocampus shows moderate granular immunoreactivity in neuronal cell bodies.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse hippocampus shows restricted positivity in the CA2/CA3 areas.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse olfactory bulb shows weak staining in the external plexiform layer.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448] - Staining of mouse pons shows cytoplasmic staining in the vestibular nucleus.
Immunocytochemistry/ Immunofluorescence: DTX4 Antibody [NBP2-32448] - Immunofluorescent staining of human cell line CACO-2 shows localization to vesicles.
Immunohistochemistry: DTX4 Antibody [NBP2-32448] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DTX4 Antibody [NBP2-32448] - Staining of human cerebellum shows strong granular cytoplasmic immunoreactivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTX4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DTX4 Protein (NBP2-32448PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DTX4 Antibody

  • Deltex 4 Homolog (Drosophila)
  • Deltex 4 Homolog
  • Deltex Homolog 4 (Drosophila)
  • deltex4
  • DTX4
  • E3 Ubiquitin-Protein Ligase DTX4
  • EC 6.3.2.
  • KIAA0937
  • Protein Deltex-4
  • RING Finger Protein 155
  • RNF155

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-13941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07900
Species: Hu
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NB100-56156
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1946
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for DTX4 Antibody (NBP2-32448) (0)

There are no publications for DTX4 Antibody (NBP2-32448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX4 Antibody (NBP2-32448) (0)

There are no reviews for DTX4 Antibody (NBP2-32448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DTX4 Antibody (NBP2-32448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DTX4 Products

DTX4 NBP2-32448

Bioinformatics Tool for DTX4 Antibody (NBP2-32448)

Discover related pathways, diseases and genes to DTX4 Antibody (NBP2-32448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTX4 Antibody (NBP2-32448)

Discover more about diseases related to DTX4 Antibody (NBP2-32448).
 

Pathways for DTX4 Antibody (NBP2-32448)

View related products by pathway.

PTMs for DTX4 Antibody (NBP2-32448)

Learn more about PTMs related to DTX4 Antibody (NBP2-32448).

Blogs on DTX4

There are no specific blogs for DTX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTX4