![Western Blot: DTX2 Antibody [H00113878-D01P] - Analysis of DTX2 expression in mouse brain.](http://images.novusbio.com/fullsize/DTX2-Antibody-Western-Blot-H00113878-D01P-img0002.jpg "Western Blot: DTX2 Antibody [H00113878-D01P] - Analysis of DTX2 expression in mouse brain.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit DTX2 Antibody - Azide and BSA Free (H00113878-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | DTX2 (NP_065943.1, 1 a.a. - 622 a.a.) full-length human protein. MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLSAASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DTX2 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DTX2 Antibody (H00113878-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DTX2 |
| Uniprot |
|
![Western Blot: DTX2 Antibody [H00113878-D01P] - Analysis of DTX2 expression in human stomach.](http://images.novusbio.com/fullsize/DTX2-Antibody-Western-Blot-H00113878-D01P-img0001.jpg "Western Blot: DTX2 Antibody [H00113878-D01P] - Analysis of DTX2 expression in human stomach.")
![Western Blot: DTX2 Antibody [H00113878-D01P] - Analysis of DTX2 expression in transfected 293T cell line by DTX2 polyclonal antibody.Lane 1: DTX2 transfected lysate(67.20 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/DTX2-Antibody-Western-Blot-H00113878-D01P-img0003.jpg "Western Blot: DTX2 Antibody [H00113878-D01P] - Analysis of DTX2 expression in transfected 293T cell line by DTX2 polyclonal antibody.Lane 1: DTX2 transfected lysate(67.20 KDa).Lane 2: Non-transfected lysate.")
![Western Blot DTX1/DTX4 Antibody (730612) [Unconjugated]](https://images.novusbio.com/images2/DTX1_MAB7157_Western_Blot_11585.jpg)
![Immunocytochemistry DTX1/DTX4 Antibody (730612) [Unconjugated]](https://images.novusbio.com/images2/DTX1_MAB7157_Immunocytochemistry_11667.jpg)
![Intracellular Staining by Flow Cytometry DTX1/DTX4 Antibody (730612) [Unconjugated]](https://images.novusbio.com/images2/DTX1_MAB7157_Flow_Cytometry_12147.jpg)
![N/A Pentraxin 2/SAP [HRP]](https://images.novusbio.com/images2/DATA_Pentraxin_2_MPTX20_ELISA_1018.jpg)
![N/A Pentraxin 2/SAP [HRP]](https://images.novusbio.com/images2/Pentraxin_2_MPTX20_ELISA_310.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![Immunohistochemistry Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Immunohistochemistry_11445.jpg)
![Western Blot Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Western_Blot_12581.jpg)
![Immunocytochemistry/ Immunofluorescence Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images/af1556_mouse-podocalyxin-affinity-purified-polyclonal-ab-41202410485429.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")