DTX1 Antibody - BSA Free

Western Blot: DTX1 Antibody [NBP2-84823] - WB Suggested Anti-DTX1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DTX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DTX1 Antibody - BSA Free (NBP2-84823) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DTX1. Peptide sequence: SRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DTX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DTX1 Antibody - BSA Free

• deltex homolog 1 (Drosophila)
• Deltex1
• DTX1
• Dx-1
• hDTX1
• hDx-1
• protein deltex-1

Background

DTX1, also known as E3 ubiquitin-protein ligase DTX1, is a 67.4 kDa, 620 amino acid protein that is involved in regulating the Notch pathway by monitoring ubiquitination and stimulating the breakdown of MEKK1. Current research is being conducted with diseases and disorders such as osteosarcoma, Noonan syndrome, and neuronitis. The protein interacts in disease and Notch signaling pathways with CRK, ITCH, UBE2D2, UBE2D3, and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DTX1