DSCR6 Antibody

Images

 
Immunohistochemistry: DSCR6 Antibody [NBP2-31034] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DSCR6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSCR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DSCR6 Protein (NBP2-31034PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DSCR6 Antibody

  • Down syndrome critical region gene 6
  • protein ripply3
  • RIPPLY3Down syndrome critical region protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-46076
Species: Hu
Applications: WB, IHC
423-F8/CF
Species: Hu, Mu
NBP1-89481
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74575
Species: Hu
Applications: WB, PEP-ELISA
NBP1-60052
Species: Hu
Applications: WB
NBP1-83091
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84295
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-12154
Species: Hu
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP2-31034
Species: Hu
Applications: IHC, IHC-P

Publications for DSCR6 Antibody (NBP2-31034) (0)

There are no publications for DSCR6 Antibody (NBP2-31034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSCR6 Antibody (NBP2-31034) (0)

There are no reviews for DSCR6 Antibody (NBP2-31034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DSCR6 Antibody (NBP2-31034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DSCR6 Products

DSCR6 NBP2-31034

Bioinformatics Tool for DSCR6 Antibody (NBP2-31034)

Discover related pathways, diseases and genes to DSCR6 Antibody (NBP2-31034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSCR6 Antibody (NBP2-31034)

Discover more about diseases related to DSCR6 Antibody (NBP2-31034).
 

Pathways for DSCR6 Antibody (NBP2-31034)

View related products by pathway.

Blogs on DSCR6

There are no specific blogs for DSCR6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DSCR6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSCR6
Uniprot