DSCAM Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DSCAM Antibody [NBP2-30716] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DSCAM Antibody [NBP2-30716] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DSCAM Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSCAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DSCAM Protein (NBP2-30716PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DSCAM Antibody

  • CHD2-42
  • CHD2-52
  • Down syndrome cell adhesion molecule
  • DSCAM
  • human CHD2-52 down syndrome cell adhesion molecule, 10CHD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3315
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF844
Species: Mu
Applications: WB, Block
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
NB100-60411
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-2307
Species: Hu
Applications: WB
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for DSCAM Antibody (NBP2-30716) (0)

There are no publications for DSCAM Antibody (NBP2-30716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSCAM Antibody (NBP2-30716) (0)

There are no reviews for DSCAM Antibody (NBP2-30716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DSCAM Antibody (NBP2-30716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DSCAM Products

Bioinformatics Tool for DSCAM Antibody (NBP2-30716)

Discover related pathways, diseases and genes to DSCAM Antibody (NBP2-30716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSCAM Antibody (NBP2-30716)

Discover more about diseases related to DSCAM Antibody (NBP2-30716).
 

Pathways for DSCAM Antibody (NBP2-30716)

View related products by pathway.

PTMs for DSCAM Antibody (NBP2-30716)

Learn more about PTMs related to DSCAM Antibody (NBP2-30716).

Blogs on DSCAM

There are no specific blogs for DSCAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DSCAM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSCAM
Entrez
Uniprot