DRP1 Recombinant Protein Antigen

Images

 
There are currently no images for DRP1 Protein (NBP2-34205PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DRP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNM1L.

Source: E. coli

Amino Acid Sequence: EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNM1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34205.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DRP1 Recombinant Protein Antigen

  • DLP1
  • DNM1L
  • DRP1
  • DRP1Dnm1p/Vps1p-like protein
  • DVLP
  • DVLPEC 3.6.5.5
  • Dymple
  • DYMPLEDYNIV-11
  • dynamin 1-like
  • Dynamin family member proline-rich carboxyl-terminal domain less
  • dynamin-1-like protein
  • Dynamin-like protein 4
  • Dynamin-like protein IV
  • Dynamin-like protein
  • Dynamin-related protein 1
  • FLJ41912
  • HdynIV
  • VPS1

Background

DRP1 is a member of the dynamin GTPase superfamily, which that contributes to mitochondrial division in mammalian cells. DRP1 plays this important role in mitochondrial fission at steady state and during apoptosis. DRP1 is required for proper cellular distribution of mitochondria, and in mutant neurons, mitochondria are largely absent from synapses. Therefore, DRP1 provides a genetic tool to assess the role of mitochondria at synapses.

The DRP1 gene has 3 alternatively spliced transcripts encoding different isoforms, which are alternatively polyadenylated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, RNAi, WB
H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
NB110-55290
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC,  IHC-P, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-60491
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
BC100-494
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-86799
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-34205PEP
Species: Hu
Applications: AC

Publications for DRP1 Protein (NBP2-34205PEP) (0)

There are no publications for DRP1 Protein (NBP2-34205PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRP1 Protein (NBP2-34205PEP) (0)

There are no reviews for DRP1 Protein (NBP2-34205PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DRP1 Protein (NBP2-34205PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DRP1 Products

Research Areas for DRP1 Protein (NBP2-34205PEP)

Find related products by research area.

Blogs on DRP1.

Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress
By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm...  Read full blog post.

Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles
By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox...  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Dynamin-related Protein 1 (DRP1) in Mitochondria and Apoptosis.
Dynamin-related Protein 1 (DRP1) is known to function in mitochondrial and peroxisomal division and mediate membrane fission through oligomerization into ring-like structure and sever the mitochondrial membrane, through a GTP hydrolysis-dependent mech...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DRP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNM1L