SERINC3 Antibody


Western Blot: SERINC3 Antibody [NBP2-13296] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunohistochemistry-Paraffin: SERINC3 Antibody [NBP2-13296] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SERINC3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK
Specificity of human SERINC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SERINC3 Recombinant Protein Antigen (NBP2-13296PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SERINC3 Antibody

  • AIGP1
  • DIFF33tumor differentially expressed 1
  • placental transmembrane protein (mouse testicular tumor differentiallyexpressed)
  • SBBI99
  • serine incorporator 3
  • TDE
  • TDE1Tumor differentially expressed protein 1
  • TMS-1
  • transmembrane protein SBBI99
  • tumour differentially expressed 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for SERINC3 Antibody (NBP2-13296) (0)

There are no publications for SERINC3 Antibody (NBP2-13296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERINC3 Antibody (NBP2-13296) (0)

There are no reviews for SERINC3 Antibody (NBP2-13296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERINC3 Antibody (NBP2-13296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SERINC3 Products

Bioinformatics Tool for SERINC3 Antibody (NBP2-13296)

Discover related pathways, diseases and genes to SERINC3 Antibody (NBP2-13296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERINC3 Antibody (NBP2-13296)

Discover more about diseases related to SERINC3 Antibody (NBP2-13296).

Pathways for SERINC3 Antibody (NBP2-13296)

View related products by pathway.

PTMs for SERINC3 Antibody (NBP2-13296)

Learn more about PTMs related to SERINC3 Antibody (NBP2-13296).

Blogs on SERINC3

There are no specific blogs for SERINC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SERINC3 Antibody and receive a gift card or discount.


Gene Symbol SERINC3