DPS Antibody


Western Blot: DPS Antibody [NBP1-54645] - HepG2 cell lysate, concentration 5.0ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DPS Antibody Summary

Synthetic peptides corresponding to PDSS1(prenyl (decaprenyl) diphosphate synthase, subunit 1) The peptide sequence was selected from the middle region of PDSS1. Peptide sequence GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE.
This product is specific to Subunit or Isoform: 1.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDSS1 and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DPS Antibody

  • All-trans-decaprenyl-diphosphate synthase subunit 1
  • Decaprenyl pyrophosphate synthase subunit 1
  • decaprenyl-diphosphate synthase subunit 1
  • DPS
  • DPS1
  • EC
  • hDPS1
  • MGC70953
  • polyprenyl pyrophosphate synthetase
  • prenyl (decaprenyl) diphosphate synthase, subunit 1
  • RP13-16H11.3
  • subunit 1 of decaprenyl diphosphate synthase
  • TPRT
  • TPT 1
  • TPTcoenzyme Q1 homolog
  • trans-prenyltransferase (TPT)
  • Trans-prenyltransferase 1
  • trans-prenyltransferase


PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for DPS Antibody (NBP1-54645) (0)

There are no publications for DPS Antibody (NBP1-54645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPS Antibody (NBP1-54645) (0)

There are no reviews for DPS Antibody (NBP1-54645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPS Antibody (NBP1-54645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DPS Products

DPS NBP1-54645

Bioinformatics Tool for DPS Antibody (NBP1-54645)

Discover related pathways, diseases and genes to DPS Antibody (NBP1-54645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPS Antibody (NBP1-54645)

Discover more about diseases related to DPS Antibody (NBP1-54645).

Pathways for DPS Antibody (NBP1-54645)

View related products by pathway.

PTMs for DPS Antibody (NBP1-54645)

Learn more about PTMs related to DPS Antibody (NBP1-54645).

Blogs on DPS

There are no specific blogs for DPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DPS Antibody and receive a gift card or discount.


Gene Symbol PDSS1