DPPA5/ESG1 Antibody

Images

 
Western Blot: DPPA5/ESG1 Antibody [NBP1-52919] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPPA5/ESG1 Antibody Summary

Immunogen
Synthetic peptides corresponding to DPPA5(developmental pluripotency associated 5) The peptide sequence was selected from the N terminal of DPPA5. Peptide sequence MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPPA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DPPA5 and was validated on Western blot.
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DPPA5/ESG1 Antibody

  • developmental pluripotency associated 5
  • developmental pluripotency-associated 5 protein
  • DPPA5
  • embryonal stem cell specific gene 1
  • Embryonal stem cell-specific gene 1 protein
  • ESG1
  • ESG1ESG-1
  • hDPPA5

Background

DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF7216
Species: Hu
Applications: IHC
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-15140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30646
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84863
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27292
Species: Hu
Applications: IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NBP1-88798
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19939
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-30762
Species: Hu
Applications: IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DPPA5/ESG1 Antibody (NBP1-52919) (0)

There are no publications for DPPA5/ESG1 Antibody (NBP1-52919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPPA5/ESG1 Antibody (NBP1-52919) (0)

There are no reviews for DPPA5/ESG1 Antibody (NBP1-52919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPPA5/ESG1 Antibody (NBP1-52919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPPA5/ESG1 Products

Bioinformatics Tool for DPPA5/ESG1 Antibody (NBP1-52919)

Discover related pathways, diseases and genes to DPPA5/ESG1 Antibody (NBP1-52919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPPA5/ESG1 Antibody (NBP1-52919)

Discover more about diseases related to DPPA5/ESG1 Antibody (NBP1-52919).
 

Pathways for DPPA5/ESG1 Antibody (NBP1-52919)

View related products by pathway.

PTMs for DPPA5/ESG1 Antibody (NBP1-52919)

Learn more about PTMs related to DPPA5/ESG1 Antibody (NBP1-52919).

Blogs on DPPA5/ESG1

There are no specific blogs for DPPA5/ESG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPPA5/ESG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPPA5
Entrez
Uniprot