DPF2 Antibody - BSA Free

Western Blot: DPF2 Antibody [NBP2-58389] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: DPF2 Antibody [NBP2-58389] - Staining of human cell line A-431 shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-DPF2 (NBP2-58389) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DPF2 Antibody - BSA Free (NBP2-58389) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
• Predicted Species: Mouse (97%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DPF2 Recombinant Protein Antigen (NBP2-58389PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DPF2 Antibody - BSA Free

• Apoptosis response zinc finger protein
• D4, zinc and double PHD fingers family 2BAF45D
• MGC10180
• Protein requiem
• REQBRG1-associated factor 45D
• requiem, apoptosis response zinc finger
• ubi-d4
• UBID4requiem, apoptosis response zinc finger gene
• zinc finger protein ubi-d4

Background

DPF2 is encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPF2