DPF2 Antibody - BSA Free

Western Blot: DPF2 Antibody [NBP1-87138] - Analysis in human cell line TD47D and human cell line THP-1.

Immunocytochemistry/Immunofluorescence: DPF2 Antibody [NBP1-87138] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: DPF2 Antibody [NBP1-87138] - Staining of human salivary gland shows weak cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DPF2 Antibody - BSA Free (NBP1-87138) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DPF2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26571505). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DPF2 Protein (NBP1-87138PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26571505).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DPF2 Antibody - BSA Free

• Apoptosis response zinc finger protein
• D4, zinc and double PHD fingers family 2BAF45D
• MGC10180
• Protein requiem
• REQBRG1-associated factor 45D
• requiem, apoptosis response zinc finger
• ubi-d4
• UBID4requiem, apoptosis response zinc finger gene
• zinc finger protein ubi-d4

Background

DPF2 is encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DPF2 Antibody (NBP1-87138)(1)

Publication using NBP1-87138

• Cruickshank VA, Sroczynska P, Sankar A et al. SWI/SNF Subunits SMARCA4, SMARCD2 and DPF2 Collaborate in MLL-Rearranged Leukaemia Maintenance. PLoS One 2015-01-01 [PMID: 26571505] (WB, Mouse)

Bioinformatics

• Gene Symbol: DPF2