DOT1L Antibody


Western Blot: DOT1L Antibody [NBP2-56641] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: DOT1L Antibody [NBP2-56641] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

DOT1L Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS
Specificity of human DOT1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
DOT1L Knockout HeLa Cell Lysate
Control Peptide
DOT1L Recombinant Protein Antigen (NBP2-56641PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for DOT1L Antibody

  • DOT1L
  • DOT1-like protein
  • DOT1-like, histone H3 methyltransferase (S. cerevisiae)
  • EC
  • H3-K79-HMTase
  • KIAA1814DKFZp586P1823
  • KMT4
  • KMT4H3 lysine-79 specific
  • Lysine N-methyltransferase 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for DOT1L Antibody (NBP2-56641) (0)

There are no publications for DOT1L Antibody (NBP2-56641).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOT1L Antibody (NBP2-56641) (0)

There are no reviews for DOT1L Antibody (NBP2-56641). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DOT1L Antibody (NBP2-56641) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DOT1L Products

Bioinformatics Tool for DOT1L Antibody (NBP2-56641)

Discover related pathways, diseases and genes to DOT1L Antibody (NBP2-56641). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOT1L Antibody (NBP2-56641)

Discover more about diseases related to DOT1L Antibody (NBP2-56641).

Pathways for DOT1L Antibody (NBP2-56641)

View related products by pathway.

PTMs for DOT1L Antibody (NBP2-56641)

Learn more about PTMs related to DOT1L Antibody (NBP2-56641).

Research Areas for DOT1L Antibody (NBP2-56641)

Find related products by research area.

Blogs on DOT1L

There are no specific blogs for DOT1L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DOT1L Antibody and receive a gift card or discount.


Gene Symbol DOT1L