KRT6L Antibody

Images

 
Immunohistochemistry-Paraffin: KRT6L Antibody [NBP2-31764] - Staining of human hair shows strong cytoplasmic positivity in external root sheath.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRT6L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT79
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KRT6L Protein (NBP2-31764PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KRT6L Antibody

  • CK-79
  • Cytokeratin-79
  • FLJ26646
  • K6Lkeratin-6L
  • K79
  • KB38
  • keratin 6L
  • keratin 79
  • keratin, type II cytoskeletal 79
  • Keratin-6L
  • Keratin-6-like
  • Keratin-79
  • KRT6Lkeratin-79
  • Type-II keratin Kb38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NB100-1566
Species: Hu
Applications: WB, IP
NB100-56633
Species: Hu
Applications: WB
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBL1-11567
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-31764
Species: Hu
Applications: IHC, IHC-P

Publications for KRT6L Antibody (NBP2-31764) (0)

There are no publications for KRT6L Antibody (NBP2-31764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT6L Antibody (NBP2-31764) (0)

There are no reviews for KRT6L Antibody (NBP2-31764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRT6L Antibody (NBP2-31764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRT6L Products

Bioinformatics Tool for KRT6L Antibody (NBP2-31764)

Discover related pathways, diseases and genes to KRT6L Antibody (NBP2-31764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT6L

There are no specific blogs for KRT6L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT6L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT79
Uniprot