KRT6L Antibody

Images

 
Western Blot: KRT6L Antibody [NBP2-31764] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunohistochemistry: KRT6L Antibody [NBP2-31764] - Liver cancer
Immunohistochemistry: KRT6L Antibody [NBP2-31764] - Staining of human skin shows strong cytoplasmic positivity in basal cells of keratinocytes.
Immunohistochemistry: KRT6L Antibody [NBP2-31764] - Skin

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

KRT6L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT79
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:250-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Control Peptide
KRT6L Protein (NBP2-31764PEP)

Alternate Names for KRT6L Antibody

  • CK-79
  • cytokeratin-79
  • FLJ26646
  • K6Lkeratin-6L
  • K79
  • KB38
  • keratin 6L
  • keratin 79
  • keratin, type II cytoskeletal 79
  • Keratin-6L
  • Keratin-6-like
  • Keratin-79
  • KRT6Lkeratin-79
  • Type-II keratin Kb38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19400
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56599
Species: Hu
Applications: WB, Flow
H00008294-P01
Species: Hu
NB21-2088
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-33412
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52488
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IHC, ICC
NBP2-31764
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KRT6L Antibody (NBP2-31764) (0)

There are no publications for KRT6L Antibody (NBP2-31764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT6L Antibody (NBP2-31764) (0)

There are no reviews for KRT6L Antibody (NBP2-31764). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRT6L Antibody (NBP2-31764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRT6L Antibody Products

Related Products by Gene

Bioinformatics Tool for KRT6L Antibody (NBP2-31764)

Discover related pathways, diseases and genes to KRT6L Antibody (NBP2-31764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT6L

There are no specific blogs for KRT6L, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol KRT79
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-31764 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought