KRT6L Antibody

Images

 
Immunohistochemistry-Paraffin: KRT6L Antibody [NBP2-31764] - Staining of human hair shows strong cytoplasmic positivity in external root sheath.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KRT6L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT79
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
KRT6L Protein (NBP2-31764PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KRT6L Antibody

  • CK-79
  • Cytokeratin-79
  • FLJ26646
  • K6Lkeratin-6L
  • K79
  • KB38
  • keratin 6L
  • keratin 79
  • keratin, type II cytoskeletal 79
  • Keratin-6L
  • Keratin-6-like
  • Keratin-79
  • KRT6Lkeratin-79
  • Type-II keratin Kb38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NB100-1566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56633
Species: Hu
Applications: WB
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00008294-P01
Species: Hu
NB21-2088
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00008361-R01
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-33412
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-31764
Species: Hu
Applications: IHC, IHC-P

Publications for KRT6L Antibody (NBP2-31764) (0)

There are no publications for KRT6L Antibody (NBP2-31764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRT6L Antibody (NBP2-31764) (0)

There are no reviews for KRT6L Antibody (NBP2-31764). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KRT6L Antibody (NBP2-31764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KRT6L Antibody Products

Related Products by Gene

Bioinformatics Tool for KRT6L Antibody (NBP2-31764)

Discover related pathways, diseases and genes to KRT6L Antibody (NBP2-31764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRT6L

There are no specific blogs for KRT6L, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KRT6L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT79
Uniprot

Customers Who Bought This Also Bought