DONSON Antibody

Images

 
Western Blot: DONSON Antibody [NBP1-70752] - Middle region validated by WB using Mouse brains at 1:1000.
Western Blot: DONSON Antibody [NBP1-70752] - Human LCL and mouse brains incubated for 5 minutes in CDP-Star for 5 minutes, Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DONSON Antibody Summary

Immunogen
Synthetic peptides corresponding to DONSON(downstream neighbor of SON) The peptide sequence was selected from the middle region of DONSON. Peptide sequence DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DONSON
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DONSON and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DONSON Antibody

  • B17
  • downstream neighbor of SON
  • protein downstream neighbor of Son

Background

This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88936
Species: Hu
Applications: IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88941
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB5756
Species: Hu
Applications: Flow
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-70752
Species: Hu, Mu
Applications: WB

Publications for DONSON Antibody (NBP1-70752) (0)

There are no publications for DONSON Antibody (NBP1-70752).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DONSON Antibody (NBP1-70752) (0)

There are no reviews for DONSON Antibody (NBP1-70752). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DONSON Antibody (NBP1-70752) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DONSON Products

Bioinformatics Tool for DONSON Antibody (NBP1-70752)

Discover related pathways, diseases and genes to DONSON Antibody (NBP1-70752). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DONSON Antibody (NBP1-70752)

View related products by pathway.

Blogs on DONSON

There are no specific blogs for DONSON, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DONSON Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DONSON