Recombinant Human Dock5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Dock5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 771-865 of Human DOCK5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RVLYLRFYGQSKDGDEFNNSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLFCKFIQSIPDNQLVRQKLNCMTKIVE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DOCK5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dock5 Protein

  • dedicator of cytokinesis 5
  • dedicator of cytokinesis protein 5
  • DKFZp451J181
  • DKFZp779M164
  • DKFZp781J211
  • FLJ21034

Background

DOCK5 - dedicator of cytokinesis 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7070
Species: Hu, Rt
Applications: WB
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB8404
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-13230
Species: Hu
Applications: IHC, IHC-P
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
NB100-1463
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00080005-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Dock5 Partial Recombinant Protein (H00080005-Q01) (0)

There are no publications for Dock5 Partial Recombinant Protein (H00080005-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dock5 Partial Recombinant Protein (H00080005-Q01) (0)

There are no reviews for Dock5 Partial Recombinant Protein (H00080005-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dock5 Partial Recombinant Protein (H00080005-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dock5 Products

Dock5 H00080005-Q01

Bioinformatics Tool for Dock5 Partial Recombinant Protein (H00080005-Q01)

Discover related pathways, diseases and genes to Dock5 Partial Recombinant Protein (H00080005-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dock5 Partial Recombinant Protein (H00080005-Q01)

Discover more about diseases related to Dock5 Partial Recombinant Protein (H00080005-Q01).
 

Pathways for Dock5 Partial Recombinant Protein (H00080005-Q01)

View related products by pathway.

PTMs for Dock5 Partial Recombinant Protein (H00080005-Q01)

Learn more about PTMs related to Dock5 Partial Recombinant Protein (H00080005-Q01).
 

Research Areas for Dock5 Partial Recombinant Protein (H00080005-Q01)

Find related products by research area.

Blogs on Dock5

There are no specific blogs for Dock5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Dock5 Antibody
NBP1-83627
LRRK2 Antibody
NB300-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dock5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK5