Dock5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Dock5 Antibody [NBP1-83627] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: Dock5 Antibody [NBP1-83627] - Staining of human tonsil shows distinct cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dock5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVVSTSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKAQR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOCK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dock5 Protein (NBP1-83627PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dock5 Antibody

  • dedicator of cytokinesis 5
  • dedicator of cytokinesis protein 5
  • DKFZp451J181
  • DKFZp779M164
  • DKFZp781J211
  • FLJ21034

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7070
Species: Hu, Rt
Applications: WB
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB8404
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-13230
Species: Hu
Applications: IHC, IHC-P
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
NB100-1463
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83627
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Dock5 Antibody (NBP1-83627) (0)

There are no publications for Dock5 Antibody (NBP1-83627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dock5 Antibody (NBP1-83627) (0)

There are no reviews for Dock5 Antibody (NBP1-83627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Dock5 Antibody (NBP1-83627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dock5 Products

Dock5 NBP1-83627

Bioinformatics Tool for Dock5 Antibody (NBP1-83627)

Discover related pathways, diseases and genes to Dock5 Antibody (NBP1-83627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dock5 Antibody (NBP1-83627)

Discover more about diseases related to Dock5 Antibody (NBP1-83627).
 

Pathways for Dock5 Antibody (NBP1-83627)

View related products by pathway.

PTMs for Dock5 Antibody (NBP1-83627)

Learn more about PTMs related to Dock5 Antibody (NBP1-83627).
 

Research Areas for Dock5 Antibody (NBP1-83627)

Find related products by research area.

Blogs on Dock5

There are no specific blogs for Dock5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dock5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK5