DOCK10 Antibody - BSA Free

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Analysis in human lymph node and pancreas tissues using NBP2-58637 antibody. Corresponding DOCK10 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: DOCK10 Antibody [NBP2-58637] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human cerrebral cortex shows moderate cytoplasmic positivity in glial cells.

Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP2-58637] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DOCK10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DOCK10 Antibody - BSA Free (NBP2-58637) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKTTRNMERLNLFSLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DOCK10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC Retrieval method: HIER pH6.
• Control Peptide:

  DOCK10 Recombinant Protein Antigen (NBP2-58637PEP)

Reactivity Notes

Mouse 85%.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DOCK10 Antibody - BSA Free

• dedicator of cytokinesis 10
• dedicator of cytokinesis protein 10
• DKFZp781A1532
• DRIP2
• KIAA0694protein zizimin 3
• Nbla10300
• ZIZ3dopamine receptor interacting protein 2
• zizimin3
• zizimin-3

Background

DOCK10 is a potential Rho-guanine nucleotide exchange factor (Rho-GEF) that may function to activate small GTPases such as Rac and Cdc42. It is a member of the CZH (CDM-zizimin homology) family of proteins that contain two highly conserved domains, CZH1 and CZH2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DOCK10