| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, PAGE, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 803-912 of Human DNMT3A Source: Wheat Germ (in vitro) Amino Acid Sequence: RPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | DNMT3A |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 37.95 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Publication using H00001788-Q01 | Applications | Species |
|---|---|---|
| Ma Y, Qiu C, Wang B et al. Autoantibody against Tumor-Associated Antigens as Diagnostic Biomarkers in Hispanic Patients with Hepatocellular Carcinoma Cells 2022-10-14 [PMID: 36291095] (ELISA) | ELISA |
Research Areas for DNMT3A Recombinant Protein (H00001788-Q01)Find related products by research area.
|
|
Epigenetics of Depression: How Can Psychological Stress Alter Your DNA? By Emily Cartwright, PhDHow Can Psychological Stress Alter Your DNA? Traumatic events, work demands, relationship conflicts, and health problems are all examples of psychological stressors that can result in phy... Read full blog post. |
|
Chromatin reader domains of DNMT-targeting protein, UHRF1, are responsible for cancerous DNA hypermethylation By Jamshed Arslan, Pharm. D., PhD. DNA methylation represses transcription of many genes, including tumor suppressor genes. A protein called UHRF1 recruits DNA methyltransferases (DNMTs) to establish and maintain DNA... Read full blog post. |
|
Eat responsibly: Epigenetic downregulation of Ankrd26 gene by long-term high-fat intake promotes obesity and inflammation By Jamshed Arslan Pharm.D. White adipose tissue (WAT) represents the primary site to store energy in humans. WAT’s endocrine regulation of energy balance is controlled by nutritional status, exercise, and hormones l... Read full blog post. |
|
The role of DNMT3A in development Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence. Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation. Gene silencing in DNA ... Read full blog post. |
|
Go Ahead! Make My DNA DNA methylation plays a critical role the long-term silencing of transcription and is essential for processes such as embryonic development, germline differentiation, and tissue maturation. Dnmt3a is a member of the C5-methyltransferase family that re... Read full blog post. |
|
DNMT's: An Overview of 3 DNA Methyltransferases DNA methyltransferases catalyze the transfer of the methyl group from S-andenosyl methionine (SAM) to DNA. Such methylation has wide ranging function in the cell, including organismal development and cell differentiation. In cancer, abnormal hypermeth... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DNMT3A |