DNMT3A Recombinant Protein Antigen

Images

 
There are currently no images for DNMT3A Protein (NBP1-85961PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNMT3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNMT3A.

Source: E.coli

Amino Acid Sequence: LPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNMT3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-85961.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DNMT3A Recombinant Protein Antigen

  • DNA (cytosine-5-)-methyltransferase 3 alpha
  • DNA (cytosine-5)-methyltransferase 3A
  • DNA cytosine methyltransferase 3A2
  • DNA methyltransferase HsaIIIA
  • DNA MTase HsaIIIA
  • DNMT3A
  • DNMT3A2
  • EC 2.1.1.37
  • M.HsaIIIA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB300-516
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P
NBP2-27098
Species: Hu, Pm
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-56271
Species: Hu
Applications: WB, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-32104
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NB200-616
Species: Hu, Mu
Applications: WB
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for DNMT3A Protein (NBP1-85961PEP) (0)

There are no publications for DNMT3A Protein (NBP1-85961PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNMT3A Protein (NBP1-85961PEP) (0)

There are no reviews for DNMT3A Protein (NBP1-85961PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DNMT3A Protein (NBP1-85961PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DNMT3A Protein (NBP1-85961PEP)

Discover related pathways, diseases and genes to DNMT3A Protein (NBP1-85961PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNMT3A Protein (NBP1-85961PEP)

Discover more about diseases related to DNMT3A Protein (NBP1-85961PEP).
 

Pathways for DNMT3A Protein (NBP1-85961PEP)

View related products by pathway.

PTMs for DNMT3A Protein (NBP1-85961PEP)

Learn more about PTMs related to DNMT3A Protein (NBP1-85961PEP).
 

Research Areas for DNMT3A Protein (NBP1-85961PEP)

Find related products by research area.

Blogs on DNMT3A.

Eat responsibly: Epigenetic downregulation of Ankrd26 gene by long-term high-fat intake promotes obesity and inflammation
By Jamshed Arslan Pharm.D. White adipose tissue (WAT) represents the primary site to store energy in humans. WAT’s endocrine regulation of energy balance is controlled by nutritional status, exercise, and hormones l...  Read full blog post.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

Go Ahead! Make My DNA
DNA methylation plays a critical role the long-term silencing of transcription and is essential for processes such as embryonic development, germline differentiation, and tissue maturation. Dnmt3a is a member of the C5-methyltransferase family that re...  Read full blog post.

DNMT's: An Overview of 3 DNA Methyltransferases
DNA methyltransferases catalyze the transfer of the methyl group from S-andenosyl methionine (SAM) to DNA. Such methylation has wide ranging function in the cell, including organismal development and cell differentiation. In cancer, abnormal hypermeth...  Read full blog post.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNMT3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNMT3A
Entrez