Recombinant Human DNAJC2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DNAJC2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-167 of Human ZRF1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKGSPGDSYQKLILQLIHLMKCYLIQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DNAJC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
45.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNAJC2 Protein

  • DnaJ (Hsp40) homolog, subfamily C, member 2
  • dnaJ homolog subfamily C member 2
  • MPHOSPH11M-phase phosphoprotein 11
  • MPP11Zuotin-related factor 1
  • ZRF1zuotin
  • ZUO1
  • zuotin related factor 1

Background

This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-86827
Species: Hu
Applications: WB
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
AF5129
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88019
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26639
Species: Hu
Applications: WB (-), IP
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-74266
Species: Hu, Mk, RM
Applications: WB, IHC
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00027000-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for DNAJC2 Recombinant Protein (H00027000-P01) (0)

There are no publications for DNAJC2 Recombinant Protein (H00027000-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC2 Recombinant Protein (H00027000-P01) (0)

There are no reviews for DNAJC2 Recombinant Protein (H00027000-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC2 Recombinant Protein (H00027000-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional DNAJC2 Products

Array H00027000-P01

Bioinformatics Tool for DNAJC2 Recombinant Protein (H00027000-P01)

Discover related pathways, diseases and genes to DNAJC2 Recombinant Protein (H00027000-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC2 Recombinant Protein (H00027000-P01)

Discover more about diseases related to DNAJC2 Recombinant Protein (H00027000-P01).
 

Pathways for DNAJC2 Recombinant Protein (H00027000-P01)

View related products by pathway.

PTMs for DNAJC2 Recombinant Protein (H00027000-P01)

Learn more about PTMs related to DNAJC2 Recombinant Protein (H00027000-P01).

Blogs on DNAJC2

There are no specific blogs for DNAJC2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNAJC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC2
COVID-19 update