DNAJB4 Antibody - BSA Free

Western Blot: DNAJB4 Antibody [NBP1-81735] - Western blot analysis in human cell line U-138MG.

Immunocytochemistry/Immunofluorescence: DNAJB4 Antibody [NBP1-81735] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.

Immunohistochemistry-Paraffin: DNAJB4 Antibody [NBP1-81735] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DNAJB4 Antibody [NBP1-81735] - Staining of human cervix, uterine shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: DNAJB4 Antibody [NBP1-81735] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: DNAJB4 Antibody [NBP1-81735] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: DNAJB4 Antibody [NBP1-81735] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNAJB4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIH
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJB4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNAJB4 Protein (NBP1-81735PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNAJB4 Antibody - BSA Free

• DjB4
• DnaJ (Hsp40) homolog, subfamily B, member 4
• dnaJ homolog subfamily B member 4
• DnaJ-like heat shock protein 40
• DNAJW
• Heat shock 40 kDa protein 1 homolog
• Heat shock protein 40 homolog
• HLJ1HSP40 homolog
• Human liver DnaJ-like protein

Background

DNAJB4 belongs to the evolutionarily conserved DNAJ/HSP40 protein family. For background information on the DNAJ family, see MIM 608375.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJB4