DNAJB12 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit DNAJB12 Antibody - Azide and BSA Free (NBP2-92179) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 250-409 of human DNAJB12 (NP_060096.3). NVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DNAJB12 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for DNAJB12 Antibody - Azide and BSA Free
Background
DNAJB12, also known as DnaJ homolog subfamily B member 12, consists of a 41.8 kDa and a 42.3 kDa isoform and is involved in stimulating ATPase in order to regulate molecular chaperone activity as a part of the DNAJ/HSP40 family. Diseases and disorders such as malaria, fundus dystrophy, choroiditis, choroideremia, and cone-rod dystrophy have been studied with the protein. The protein acts in the protein processing pathway in the endoplasmic reticulum along with MME, MYC, HSPA2, TNFRSF1A, and WIPI2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Mu
Applications: Block, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for DNAJB12 Antibody (NBP2-92179) (0)
There are no publications for DNAJB12 Antibody (NBP2-92179).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNAJB12 Antibody (NBP2-92179) (0)
There are no reviews for DNAJB12 Antibody (NBP2-92179).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNAJB12 Antibody (NBP2-92179) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNAJB12 Products
Research Areas for DNAJB12 Antibody (NBP2-92179)
Find related products by research area.
|
Blogs on DNAJB12