DNAJC7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DNAJC7 Antibody [NBP1-86920] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Analysis in human cell line HEK 293.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNAJC7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAJC7 Antibody - BSA Free (NBP1-86920) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNAJC7 Protein (NBP1-86920PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNAJC7 Antibody - BSA Free

• DANJC7
• DJ11
• DnaJ (Hsp40) homolog, subfamily C, member 7
• tetratricopeptide repeat domain 2
• Tetratricopeptide repeat protein 2
• TPR repeat protein 2
• TPR2DJC7
• TTC2dnaJ homolog subfamily C member 7

Background

DNAJC7 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC7