DMC1 Antibody

Images

 
Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human testis shows strong nuclear positivity in subsets of cells in ductus seminiferus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DMC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DMC1 Protein (NBP1-82838PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DMC1 Antibody

  • disrupted meiotic cDNA1, yeast, homolog of
  • DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologousrecombination (yeast)
  • DMC1 homologue
  • HsLim15
  • LIM15yeast homolog) meiosis-specific homologousrecombination
  • meiotic recombination protein DMC1/LIM15 homolog
  • MGC150472
  • MGC150473

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-58172
Species: Hu
Applications: WB
NBP1-92301
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-176
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
H00084057-T01
Species: Hu
NBP2-58116
Species: Hu
Applications: ICC/IF
MAB2476
Species: Hu
Applications: WB, IHC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-83416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-58170
Species: Hu
Applications: WB
NBP1-82838
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for DMC1 Antibody (NBP1-82838) (0)

There are no publications for DMC1 Antibody (NBP1-82838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMC1 Antibody (NBP1-82838) (0)

There are no reviews for DMC1 Antibody (NBP1-82838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DMC1 Antibody (NBP1-82838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DMC1 Products

Bioinformatics Tool for DMC1 Antibody (NBP1-82838)

Discover related pathways, diseases and genes to DMC1 Antibody (NBP1-82838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMC1 Antibody (NBP1-82838)

Discover more about diseases related to DMC1 Antibody (NBP1-82838).
 

Pathways for DMC1 Antibody (NBP1-82838)

View related products by pathway.

PTMs for DMC1 Antibody (NBP1-82838)

Learn more about PTMs related to DMC1 Antibody (NBP1-82838).
 

Research Areas for DMC1 Antibody (NBP1-82838)

Find related products by research area.

Blogs on DMC1.

Determining DMC1's role in Homologus Recombination
The DMC1 gene encodes a 36.7 kDa nuclear protein involved in meiotic homologous recombination. This recombinase is functionally related to the yeast RAD51 and E. coli RecA genes. In contrast to RAD51, which functions in both mitotic and meiotic recomb...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DMC1